Cart
sales@molnova.com
Home - Products - Others - Other Targets - Coppersensor 1

Coppersensor 1

CAS No. 874748-20-6

Coppersensor 1 ( CS1 )

Catalog No. M28340 CAS No. 874748-20-6

Coppersensor 1 is a boron dipyrromethene-based fluorescent sensor for selective and sensitive detection of copper(I) ions (Cu + ) in biological samples. Coppersensor 1 can be imaged using any type of fluorescence microscope, including epifluorescence, confocal and multiphoton.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 205 Get Quote
100MG Get Quote Get Quote
200MG Get Quote Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote
Group Booking Get Quotation Bulk Inquiry Add to Cart

Biological Information

  • Product Name
    Coppersensor 1
  • Note
    Research use only, not for human use.
  • Brief Description
    Coppersensor 1 is a boron dipyrromethene-based fluorescent sensor for selective and sensitive detection of copper(I) ions (Cu + ) in biological samples. Coppersensor 1 can be imaged using any type of fluorescence microscope, including epifluorescence, confocal and multiphoton.
  • Description
    Coppersensor 1 is a boron dipyrromethene-based fluorescent sensor for selective and sensitive detection of copper(I) ions (Cu + ) in biological samples. Coppersensor 1 can be imaged using any type of fluorescence microscope, including epifluorescence, confocal and multiphoton.(In Vitro):Coppersensor 1 (1 mM) matches the absorption maximum of the apo and Cu + -bound probe with 543 nm excitation.
  • Synonyms
    CS1
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    unfolded protein response (UPR)
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    874748-20-6
  • Formula Weight
    629.8
  • Molecular Formula
    C30H50BF2N3S4
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    [F-][B+3]1([F-])[N]=2C(C(=C(C2C)CC)C)=C(C3=C(C(=C([N-]31)C)CC)C)CN(CCSCCSCC)CCSCCSCC
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

1.Boudreau MW, et al. A small-molecule activator of the unfolded protein response eradicates human breast tumors in mice. Sci Transl Med. 2021;13(603):eabf1383.
Calculator

Molecular Weight Calculator

Dilution Calculator

Molarity Calculator

molnova catalog
related products

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • PACAP-38 (31-38), hu...

    PACAP-38 (31-38), human, mouse, rat (TFA) demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal.

  • Suritozole

    Suritozole is a negative modulator at the gamma-aminobutyric acidA (GABAA) receptorSuritozole is a negative modulator at the gamma-aminobutyric acidA (GABAA) receptor that enhances cholinergic function, in attenuating spatial memory deficits after traumatic brain injury in the rat.

Sign In Join Free